Sequence: MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQF
DCN1, defective in cullin neddylation 1, domain containing 1; DCN1-like protein 1; DCNL1; DCUN1 domain-containing protein 1; DCUN1L1/RP42/SCCRO/SCRO/Tes3; Defective in cullin neddylation protein 1-like protein 1; RP42 homolog; squamous cell carcinoma related oncogene; Squamous cell carcinoma-related oncogene
Cat # 16107496
100 µg
Cat # 16170819
100 µL
Cat # 16817703
150 µL
Cat # 13435257
100 µL
Cat # 16117496
100 µg
Cat # 16137480
100 uL
Cat # 16397654
100 µL
Cat # 11337263
100 µg
Cat # 16043227
100 ug
Cat # 16370255
100 µL
Cat # 13425257
100 µL
Cat # 17157553
100 µL
Cat # 16180819
100 µg
Cat # 16827703
20 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.