Sequence: KVPVKEIKINPEKLIDVQKKLESILAQDQDLKERAQRCFVSYVRSVYLMKDKEVFDVSKLPIPEYALSLGLAVAPRVRFLQKMQKQPTKELVRSQADKVIEPRAPSLTNDEVEEFRAYFNEKMSILQKGGKRLEGTEHRQDNDTGNEE
DDX10-NUP98 fusion protein type 2; DEAD (Asp-Glu-Ala-Asp) box polypeptide 10; DEAD box protein 10; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 10 (RNA helicase); HRH-J8; Probable ATP-dependent RNA helicase DDX10
Cat # 16143380
100 uL
Cat # 15849763
100 µL
Cat # 16616954
100 µL
Cat # 15730041
100 µL
Cat # 16837854
20 µL
Cat # 16827854
150 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.