Sequence: SHHGGAPKASTWVVASRRSSTVSRAPERRPAEELNRTGPEGYSVGRGGRWRGTSRPPEAVAAGHEELPLCFALKSHFVGAVIGRGGSKI
Cancer/testis antigen 13; CT13; DEAD (Asp-Glu-Ala-Asp) box polypeptide 43; DEAD box protein 43; DEAD box protein HAGE; DEAD-box protein 43; DKFZp434H2114/HAGE; Helical antigen; Probable ATP-dependent RNA helicase DDX43
Cat # 16188166
100 µg
Cat # 16827524
150 µL
Cat # 16837524
20 µL
Cat # 13486007
100 µL
Cat # 15664325
100 µL
Cat # 16547991
100 µL
Cat # 16181539
100 µg
Cat # 16636954
100 µL
Cat # 15724631
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.