Sequence: TALQIGDSLNTEKATLIVVHTDGSIVETTGLKGPAAPLTPGPQSPPTPLAPGQEKGGTKYNWDPSVYDSELPVRCRNISGTLYKNRLGSG
DEAF1 transcription factor; Deformed epidermal autoregulatory factor 1 homolog; Nuclear DEAF-1-related transcriptional regulator; NUDR; NUDR/SPN/ZMYND5; Suppressin; Zinc finger MYND domain-containing protein 5
Cat # 16095245
100 µg
Cat # 13404887
100 µL
Cat # 17180254
100 µg
Cat # 15538952
100 µg
Cat # 15548952
100 µg
Cat # 16005255
100 µg
Cat # 16075245
100 µg
Cat # 16102696
50 uL
Cat # 13493447
100 µL
Cat # 16132696
100 µg
Cat # 16838404
20 µL
Cat # 16142696
200 uL
Cat # 16828404
150 µL
Cat # 17171524
100 µL
Cat # 16085245
100 µg
Cat # 16370095
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.