Sequence: IITRHDLLPYVTLKRRRAVCPDLVDKYLEETSIRYVTPRALSDPEPRPPQPSKTVPPHYPVVCCPTSGPQMCSKRPARGRATLGSQRKRRKSVTPDPKEK
CASP8IP1/DEDD1/DEFT/FLDED1/KE05; Death effector domain-containing protein; Death effector domain-containing testicular molecule; DEDPro1; FLDED-1
Cat # 16120126
100 µg
Cat # 13219448
100 µL
Cat # 16837453
20 µL
Cat # 16310115
100 µL
Cat # 16391875
100 µL
Cat # 16326984
100 µl
Cat # 17257873
100 µL
Cat # 17190254
100 µL
Cat # 16827453
150 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.