Sequence: MAADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGIS
Density-regulated protein; DRP; DRP/DRP1/SMAP-3; Protein DRP1; SMAP-3; smooth muscle cell associated protein-3; Smooth muscle cell-associated protein 3
Cat # 16128835
50 uL
Cat # 16138835
100 µg
Cat # 16567291
100 µL
Cat # 16857173
20 µL
Cat # 16646954
100 µL
Cat # 13484767
100 µL
Cat # 15954384
200 µL
Cat # 15941465
100 µg
Cat # 15722441
100 µL
Cat # 16155018
50 µg
Cat # 17130104
100 µL
Cat # 16847173
150 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.