Sequence: SHSTQVLPEFPPAEAQAPDQTDSSGQKKPDPFKIWAQSRSMYENRPMSPSPASGLSKGEREREINSTNFGECPIPDYQEQDIFLWRKETGFGFRILGGN
AIP-3; AIP3/BAIAP1/BAP1/MAGI-1/TNRC19/WWP3; Atrophin-1-interacting protein 3; BAI1-associated protein 1; BAP-1; MAGI-1; Membrane-associated guanylate kinase inverted 1; Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; Trinucleotide repeat-containing gene 19 protein; WW domain-containing protein 3; WWP3
Cat # 16110206
100 µg
Cat # 15917884
100 µL
Cat # 16190196
50 uL
Cat # 11535593
50 µL
Cat # 16163412
50 µg
Cat # 13481897
100 µL
Cat # 16826485
150 µL
Cat # 16836485
20 µL
Cat # 10368379
400 µL
Cat # 15704791
100 µL
Cat # 16100206
100 µg
Cat # 16014337
400 uL
Cat # 16128520
100 µL
Cat # 15715126
0.1 ml
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.