Sequence: LKVGDHISAVNGQSIVELSHDNIVQLIKDAGVTVTLTVIAEEEHHGPPSGTNSARQSPALQHRPMGQSQANHIPGDRSALEGEIGKDVSTSYRHSWSDHKHLAQPDTAVISVVGSRHNQNLGCYPVELERGPRGFGFSLRG
MAGI-3; MAGI-3/MGC163281/RP4-730K3.1/dJ730K3.2; Membrane-associated guanylate kinase inverted 3; Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3; membrane-associated guanylate kinase-related 3
Cat # 16143480
100 uL
Cat # 11525932
250 µg
Cat # 11535932
250 µg
Cat # 16049076
250 ug
Cat # 15947704
100 µL
Cat # 16039076
250 ug
Cat # 13415977
100 µL
Cat # 17138663
100 µL
Cat # 11524902
50 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.