Sequence: AESRPLDSRFPLEGASDADIGENALLTYRLSPNEYFFLDVPTSNQQVKPLGLVLRKLLDREETPELHLLLTATDGGKPELTGTVQLLITVLDNNDNAPV
CNR4/CNRN4/CNRS4/CRNR4/PCDH-ALPHA7; KIAA0345-like 7; ortholog to mouse CNR4; PCDH-alpha-7; Protocadherin alpha-7
Cat # 16148666
50 uL
Cat # 16168666
100 µg
Cat # 15602715
400 µL
Cat # 15622405
100 µg
Cat # 16158666
100 µg
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.