Sequence: TIYSEVATLISQNESRPHFLIELFHELQLLNTDYLRQRALYALQDIVSRHISESHEKGENVKSVNSGTWIASNSELTPSESLATTDDETFEKNFE
hPCM-1; PCM-1; Pericentriolar material 1 protein; pericentriolar material 1, PCM1; PTC4
Cat # 16019869
100 µL
Cat # 16161118
50 µg
Cat # 16899334
20 µL
Cat # 15749240
100 µL
Cat # 15712711
100 µL
Cat # 10272880
400 µL
Cat # 16889334
150 µL
Cat # 15782701
100 µL
Cat # 15706277
0.1 ml
Cat # 16578661
100 µL
Cat # 15973285
100 µL
Cat # 16629284
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.