Sequence: LIGDLPQTPPGAVPDPSLASTDSSEPSPLAGDGAPWSGSSMADTPMSPLLKGSLSQELSKSFLTLTRPDRALVRTSSRREQRRGAGGYQPLDRRGSGEPTPQKAGSSDSCFS
FLJ22427; Pecanex homolog protein 3; pecanex-like 3; Pecanex-like protein 3
Cat # 16113970
100 uL
Cat # 15781651
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.