Sequence: GGRRDELEEGAPSEAMLRLLQSAFSKNSPPKQSPKKSPTAKLNIPYENFYEALEKLNKPSQLKDSEDSLYNDYVDVFYNTKPYKHRDDRLLQALVDILNEEN
BMIQ12/NEC1/PC1/PC3/SPC3; NEC 1; Neuroendocrine convertase 1; PC1; Prohormone convertase 1; prohormone convertase 3; Proprotein convertase 1
Cat # 16102465
100 µg
Cat # 13444147
100 µL
Cat # 16112465
100 µg
Cat # 15564392
100 µL
Cat # 11571462
100 µg
Cat # 16192455
50 uL
Cat # 11566162
50 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.