Sequence: DGQSICGELSIQEHCENKPVIIGWNRNRAALSQKPLNNNNEDDEGISHVPKPYGNNDSAKKMSDNNNGLTEVLKEIAGLDTAPQIR
FLJ21140/FLJ34483/KIAA2002; Inactive tyrosine-protein kinase PEAK1; NKF3 kinase family member; Pseudopodium-enriched atypical kinase 1; Sugen kinase 269; Tyrosine-protein kinase SgK269
Cat # 16158800
100 µL
Cat # 15713251
100 µL
Cat # 15604085
100 µL
Cat # 16160087
100 µg
Cat # 15763221
100 µL
Cat # 16648414
100 µL
Cat # 16170087
100 µg
Cat # 16140087
100 µg
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.