Rekombinanta proteiner
Modifierade eller manipulerade proteiner kodade av rekombinant DNA och lämpliga för en mängd olika ändamål, inklusive modifiering av gensekvenser, massproteinproduktion och tillverkning av kommersiella produkter.
Keyword Search:
pH Paper and Buffers
Rensa alla val
Filtrerade sökresultat
Produkter från vissa av våra leverantörer visas inte i filtrerade sökresultat. Vänligen
Rensa alla filter
för att se dessa produkter.
1
–
7
av
7
Resultat
Abnova™ Human ACPP Full-length ORF (NP_001090.2, 1 a.a. - 386 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
| Förvaringskrav | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
|---|---|
| Art | Wheat Germ (in vitro) |
| Rekombinant | Recombinant |
| Form | Liquid |
| Vanligt namn | ACPP |
| Kvalitetskontrolltestning | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Gensymbol | ACPP |
| Namn | ACPP (Human) Recombinant Protein (P01) |
| Uttryckssystem | wheat germ expression system |
| Gene Alias | ACP-3/ACP3/PAP |
| Reningsmetod | Glutathione Sepharose 4 Fast Flow |
| Molekylvikt (g/mol) | 71kDa |
| Regulatorisk status | RUO |
| Formulering | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| För användning med (applikation) | Antibody Production,Protein Array,ELISA,Western Blot |
| Protein Tag | GST |
| Gen-ID (Entrez) | 55 |
| Tillträdesnummer | NP_001090.2 |
| Gensymbol | PAPSS2 |
|---|---|
| Förvaringskrav | Store at -80°C. Avoid freeze-thaw cycles. |
| Gene Alias | 3'-phosphoadenosine 5'-phosphosulfate synthase 2, ATP sulfurylase/adenosine 5'-phosphosulfate kinase, ATPSK2ATP sulfurylase/APS kinase 2, bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2, bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthethase 2, EC 2.7.1.25, PAPS synthase 2, PAPS synthetase 2, PAPSS 2, SK 2, SK2, Sulfurylase kinase 2,3-prime-phosphoadenosine 5-prime-phosphosulfate synthase 2 |
| Molekylvikt (g/mol) | 95.9 kDa |
| Formulering | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Forskningskategori | Stem Cell Markers |
| För användning med (applikation) | Western Blot,ELISA,Protein Array,Immunoaffinity Purification |
| Protein | PAPSS2 |
| Renhet eller kvalitetsklass | >80% by SDS-PAGE and Coomassie blue staining |
| Gen-ID (Entrez) | 9060 |
| Gensymbol | PAPSS2 |
|---|---|
| Förvaringskrav | Store at -80°C. Avoid freeze-thaw cycles. |
| Gene Alias | 3'-phosphoadenosine 5'-phosphosulfate synthase 2, ATP sulfurylase/adenosine 5'-phosphosulfate kinase, ATPSK2ATP sulfurylase/APS kinase 2, bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2, bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthethase 2, EC 2.7.1.25, PAPS synthase 2, PAPS synthetase 2, PAPSS 2, SK 2, SK2, Sulfurylase kinase 2,3-prime-phosphoadenosine 5-prime-phosphosulfate synthase 2 |
| Molekylvikt (g/mol) | 36.74 kDa |
| Formulering | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Forskningskategori | Stem Cell Markers |
| För användning med (applikation) | Western Blot,ELISA,Protein Array,Immunoaffinity Purification |
| Protein | PAPSS2 |
| Renhet eller kvalitetsklass | >80% by SDS-PAGE and Coomassie blue staining |
| Gen-ID (Entrez) | 9060 |
Abnova™ Human REG3A Full-length ORF (AAH36776, 1 a.a. - 175 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
| Förvaringskrav | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
|---|---|
| Art | Wheat Germ (in vitro) |
| Rekombinant | Recombinant |
| Form | Liquid |
| Vanligt namn | REG3A |
| Kvalitetskontrolltestning | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Gensymbol | REG3A |
| Namn | REG3A (Human) Recombinant Protein (P02) |
| Uttryckssystem | wheat germ expression system |
| Gene Alias | HIP/INGAP/PAP/PAP-H/PAP1/PBCGF/REG-III/REG3 |
| Reningsmetod | Glutathione Sepharose 4 Fast Flow |
| Immunogen | MLPPMALPSVSWMLLSCLMLLSQVQGEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD |
| Molekylvikt (g/mol) | 44.77kDa |
| Regulatorisk status | RUO |
| Formulering | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| För användning med (applikation) | Antibody Production,Protein Array,ELISA,Western Blot |
| Protein Tag | GST |
| Gen-ID (Entrez) | 5068 |
| Tillträdesnummer | AAH36776 |
Abnova™ Human MTMR12 Partial ORF (NP_061934, 648 a.a. - 747 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
| Förvaringskrav | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
|---|---|
| Art | Wheat Germ (in vitro) |
| Rekombinant | Recombinant |
| Form | Liquid |
| Vanligt namn | MTMR12 |
| Kvalitetskontrolltestning | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Gensymbol | MTMR12 |
| Namn | MTMR12 (Human) Recombinant Protein (Q01) |
| Uttryckssystem | wheat germ expression system |
| Gene Alias | 3-PAP/PIP3AP |
| Immunogen | PEAQILGGGQVATLSKLLEMMEEVQSLQEKIDERHHSQQAPQAEAPCLLRNSARLSSLFPFALLQRHSSKPVLPTSGWKALGDEDDLAKREDEFVDLGDV |
| Molekylvikt (g/mol) | 36.74kDa |
| Regulatorisk status | RUO |
| Formulering | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| För användning med (applikation) | Antibody Production,ELISA,Protein Array,Western Blot |
| Protein Tag | GST |
| Gen-ID (Entrez) | 54545 |
| Tillträdesnummer | NP_061934 |
Abnova™ Human DDEF2 Partial ORF (NP_003878, 909 a.a. - 1006 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
| Förvaringskrav | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
|---|---|
| Art | Wheat Germ (in vitro) |
| Rekombinant | Recombinant |
| Form | Liquid |
| Vanligt namn | ASAP2 |
| Kvalitetskontrolltestning | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Gensymbol | ASAP2 |
| Namn | DDEF2 (Human) Recombinant Protein (Q01) |
| Uttryckssystem | wheat germ expression system |
| Gene Alias | AMAP2/CENTB3/DDEF2/FLJ42910/KIAA0400/PAG3/PAP/Pap-alpha/SHAG1 |
| Immunogen | RGPVDLSATEALGPLSNAMVLQPPAPMPRKSQATKLKPKRVKALYNCVADNPDELTFSEGDVIIVDGEEDQEWWIGHIDGDPGRKGAFPVSFVHFIAD |
| Molekylvikt (g/mol) | 36.52kDa |
| Regulatorisk status | RUO |
| Formulering | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| För användning med (applikation) | Antibody Production,ELISA,Protein Array,Western Blot |
| Protein Tag | GST |
| Gen-ID (Entrez) | 8853 |
| Tillträdesnummer | NP_003878 |