accessibility menu, dialog, popup

UserName

Primära antikroppar

Primära antikroppar är immunglobuliner som känner igen och binder till ett specifikt antigen av intresse med hög affinitet och specificitet för att rena, detektera och mäta det antigenet. Inkluderar antikroppspar för specifika biokemiska tillämpningar.
Alla primära antikroppar (87,937)
Primary Antibody Matched Pairs (14)

Filtrerade sökresultat

Produkter från vissa av våra leverantörer visas inte i filtrerade sökresultat. Vänligen Rensa alla filter för att se dessa produkter.

Begränsa resultat

Välj filter

Klart

Keyword Search

cell biology

Begränsa resultat

Begränsa resultat

Inga resultat hittades inom denna kategori. Försök att ta bort några valda filter och försök igen.

Kategori

Specialerbjudande

  • (1,174)

Varumärken

  • (153)
  • (1,678)
  • (570)
  • (93)
  • (1)
  • (81,931)
  • (3,513)
  • (12)

specialprogram

  • (1)
  • (11)

Användningsområden

  • (23)
  • (12)
  • (28)
  • (116)
  • (16)
  • (193)
  • (83)
Visa alla

Klassificering

  • (59,213)
  • (10)
  • (24,519)

Konjugera

  • (2,199)
  • (372)
  • (3)
  • (20)
  • (2,003)
  • (2,199)
  • (2,233)
Visa alla

Kvantitet

  • (1)
  • (291)
  • (163)
  • (187)
  • (177)
  • (37)
  • (58)
Visa alla

Värd art

  • (102)
  • (130)
  • (1,479)
  • (56)
  • (1,878)
  • (42,758)
  • (32,327)
Visa alla

Målarter

  • (15)
  • (42)
  • (72)
  • (5)
  • (165)
  • (16)
  • (182)
Visa alla

Isotyp

  • (2)
  • (1)
  • (4)
  • (3)
  • (11)
  • (30,547)
  • (5,328)
Visa alla

Regulatorisk status

  • (48)
  • (79,879)

Form

  • (34)
  • (54)
  • (70)
  • (458)
  • (59)
  • (15)
  • (14)
Visa alla
1 – 15 av 83,940 Resultat
1

Chymase/CMA1/Mast Cell Chymase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Innehåll och lagring Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Användningsområden Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin)
Värd art Rabbit
Klassificering Polyclonal
Primär eller sekundär Primary
Antigen Chymase/CMA1/Mast Cell Chymase
Gene Alias Alpha-chymase, chymase, chymase 1 preproprotein transcript E, chymase 1 preproprotein transcript I, chymase 1, mast cell, chymase, heart, chymase, mast cell, CYH, CYM, EC 3.4.21, EC 3.4.21.39, Mast cell protease I, MCT1, MGC119890, MGC119891
Reningsmetod Affinity Purified
Gensymboler CMA1
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: GRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDS
Formulering PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Målarter Human
Regulatorisk status RUO
Utspädning Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Testspecificitet Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotyp IgG
Genaccessionsnr. P23946
Konjugera Unconjugated
Forskningsdisciplin Cell Biology, Cytoskeleton Markers, Immunology, Innate Immunity, Mast Cell Markers
Gen-ID (Entrez) 1215
3

Chymase/CMA1/Mast Cell Chymase Antibody (CC1), Novus Biologicals™

Mouse Monoclonal Antibody has been used in 2 publications

Innehåll och lagring Store at 4C. Do not freeze.
Form Purified
Värd art Mouse
Klassificering Monoclonal
Primär eller sekundär Primary
Antigen Chymase/CMA1/Mast Cell Chymase
Klona CC1
Gene Alias Alpha-chymase, chymase, chymase 1 preproprotein transcript E, chymase 1 preproprotein transcript I, chymase 1, mast cell, chymase, heart, chymase, mast cell, CYH, CYM, EC 3.4.21, EC 3.4.21.39, Mast cell protease I, MCT1, MGC119890, MGC119891
Reningsmetod Protein A or G purified
Gensymboler CMA1
Immunogen BALB/C mice were injected with a purified human skin chymase.
Målarter Human
Regulatorisk status RUO
Testspecificitet This reacts with mast cells distributed in skin, synovium, lung and heart.
Isotyp IgG1
Genaccessionsnr. P23946
Konjugera Unconjugated
Forskningsdisciplin Cell Biology, Cytoskeleton Markers, Immunology, Innate Immunity, Mast Cell Markers
Gen-ID (Entrez) 1215
4

Mast Cell Marker Antibody (MCG35) - BSA Free, Novus Biologicals™

Mouse Monoclonal Antibody

Innehåll och lagring Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Användningsområden Immunohistochemistry
Form Purified
Värd art Mouse
Klassificering Monoclonal
Koncentration 1 mg/mL
Primär eller sekundär Primary
Antigen Mast Cell Marker
Klona MCG35
Reningsmetod Protein A purified
Immunogen Spleen cells and bone marrow cells (erythrocyte depleted) from a patient with systemic mastocytosis. The bone marrow preparation consisted of 50% typical mast cells.
Formulering PBS
Målarter Human
Regulatorisk status RUO
Utspädning Immunohistochemistry 1:10 - 1:500
Isotyp IgG1 κ
Konjugera Unconjugated
Forskningsdisciplin Cardiovascular Biology
5

L1 Cell Adhesion Molecule Ab-1 Mouse Monoclonal Antibody, Epredia™

Recommended for Immunohistochemistry (Formalin/paraffin), Western Blotting and Immunoprecipitation (Native and denatured), Epredia™ L1 Cell Adhesion Molecule Ab-1, Mouse Monoclonal Antibody provides accurate, reproducible results.

Användningsområden Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot
Antigen L1 Cell Adhesion Molecule Ab-1
Klona UJ127
Immunogen Homogenous suspension of 16 week human fetal brain
Värd art Mouse
Klassificering Monoclonal
Målarter Human
Regulatorisk status RUO
Primär eller sekundär Primary
Isotyp IgG2a κ
Forskningsdisciplin Cancer and Tumor Biology
7

Panendothelial Cell Antigen Antibody (MECA-32), Alexa Fluor™ 488, Novus Biologicals™

Rat Monoclonal Antibody

Innehåll och lagring Store at 4°C in the dark.
Användningsområden Western Blot,Flow Cytometry,Immunohistochemistry,Immunocytochemistry/Immunofluorescence,Immunoprecipitation
Form Purified
Värd art Rat
Klassificering Monoclonal
Primär eller sekundär Primary
Antigen Panendothelial Cell Antigen
Klona MECA-32
Gene Alias FELS, Fenestrated endothelial-linked structure protein, gp68, MECA32, MECA-32, Panendothelial Cell Antigen, plasmalemma vesicle associated protein, Plasmalemma Vesicle Protein 1, PV-1 protein
Reningsmetod Protein G purified
Immunogen Mouse lymph node stromal cells.
Formulering 50mM Sodium Borate
Målarter Human,Mouse
Regulatorisk status RUO
Isotyp IgG2a κ
Konjugera Alexa Fluor 488
Forskningsdisciplin Cancer, Cell Biology, Cellular Markers, Endothelial Cell Markers, Extracellular Matrix, Hypoxia, Immunology, Mesenchymal Stem Cell Markers, Stem Cell Markers
Gen-ID (Entrez) 84094
8

CD31/PECAM-1 (Endothelial Cell Marker) Rabbit Polyclonal Antibody, Epredia™

Ensure accurate, reproducible results in immunohistochemistry procedures with Epredia™ CD31/PECAM-1 (Endothelial Cell Marker), Rabbit Polyclonal Antibody.

Användningsområden Immunohistochemistry (Paraffin)
Antigen CD31 (Endothelial Cell Marker)
Reningsmetod Tonsil
Immunogen Synthetic peptide corresponding to C-terminus of mouse CD31 protein
Värd art Rabbit
Klassificering Polyclonal
Målarter Human
Regulatorisk status RUO
Primär eller sekundär Primary
Konjugera Unconjugated
Forskningsdisciplin Cancer and Tumor Biology
12

Renal Cell Carcinoma Marker (gp200) Ab-1 Mouse Monoclonal Antibody, Epredia™

Provide accurate, reproducible results with the Epredia™ Renal Cell Carcinoma Marker (gp200) Ab-1, Mouse Monoclonal Antibody.

Användningsområden Immunohistochemistry (Paraffin),Western Blot
Antigen Renal Cell Carcinoma Marker (gp200) Ab-1
Klona PN-15
Immunogen Microsomal fraction of human renal cortical tissue homogenate
Värd art Mouse
Klassificering Monoclonal
Regulatorisk status IVD
Primär eller sekundär Primary
Forskningsdisciplin Cancer and Tumor Biology
13

Epredia™ Lab Vision™ Desmin (Muscle Cell Marker) Ab-1, Mouse Monoclonal Antibody

Specifically detect desmin in human, baboon, monkey, cow, cat, dog, hamster, rat and chicken samples.

Användningsområden Immunofluorescence,Immunohistochemistry (Paraffin)
Antigen Desmin (Muscle Cell Marker) Ab-1
Klona D33
Immunogen Desmin from human muscle
Värd art Mouse
Klassificering Monoclonal
Regulatorisk status IVD
Primär eller sekundär Primary
Konjugera Unconjugated
Forskningsdisciplin Muscle Biology