Läs mer
Invitrogen™ ACACB Polyclonal Antibody

Rabbit Polyclonal Antibody
Brand: Invitrogen™ PA5114376
Beskrivning
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat skeletal muscle tissue, mouse skeletal muscle tissue. IHC: rat testis tissue. Flow: HL-60 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Catalyzes the ATP-dependent carboxylation of acetyl-CoA to malonyl-CoA. Carries out three functions: biotin carboxyl carrier protein, biotin carboxylase and carboxyltransferase. Involved in inhibition of fatty acid and glucose oxidation and enhancement of fat storage. May play a role in regulation of mitochondrial fatty acid oxidation through malonyl-CoA-dependent inhibition of carnitine palmitoyltransferase 1.
Specifikationer
| ACACB | |
| Polyclonal | |
| Unconjugated | |
| ACACB | |
| Acacb; Acc2; ACCB; ACC-beta; acetyl-CoA carboxylase 2; acetyl-CoA carboxylase beta; acetyl-Coenzyme A carboxylase 2; acetyl-Coenzyme A carboxylase beta; AI597064; AW743042; Biotin carboxylase; HACC275 | |
| Rabbit | |
| Affinity chromatography | |
| RUO | |
| 100705, 116719, 32 | |
| -20°C | |
| Lyophilized |
| Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot | |
| 500 μg/mL | |
| PBS with 4mg trehalose and 0.05mg sodium azide | |
| E9Q4Z2, O00763 | |
| ACACB | |
| A synthetic peptide corresponding to a sequence of human Acetyl Coenzyme A Carboxylase/ACACB (EENPEVAVDCVIYLSQHISPAERAQVVHLLSTMD). | |
| 100 μg | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.