missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ ACP1 (Human) Recombinant Protein
Human ACP1 full-length ORF ( AAH07422, 1 a.a. - 158 a.a.) recombinant protein with GST-tag at N-terminal.
4515.00 SEK - 6845.00 SEK
Specifications
| Accession Number | AAH07422 |
|---|---|
| Gene ID (Entrez) | 52 |
| Name | acid phosphatase 1, soluble |
| Preparation Method | Wheat germ expression system |
| Quality Control Testing | 125% SDS-PAGE Stained with Coomassie Blue |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16121191
|
Abnova™
H00000052-P01.10UG |
10 μg |
4515.00 SEK
10µg |
Estimated Shipment: 29-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
|
16131191
|
Abnova™
H00000052-P01.25UG |
25 μg |
6845.00 SEK
25µg |
Estimated Shipment: 29-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
- Sequence: MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
Specifications
| AAH07422 | |
| acid phosphatase 1, soluble | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| HAAP, MGC111030, MGC3499 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |
| 52 | |
| Wheat germ expression system | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| ACP1 | |
| GST |