missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. ADAMTS2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

ADAMTS2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Produktkod. 18322814 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
18322814 25 μg
18376744 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18322814 Leverantör Novus Biologicals Leverantörsnummer NBP31720825UL

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Rabbit Polyclonal Antibody

ADAMTS2 Polyclonal antibody specifically detects ADAMTS2 in Human samples. It is validated for Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen ADAMTS2
Användningsområden Immunofluorescence
Klassificering Polyclonal
Konjugera Unconjugated
Utspädning Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Formulering PBS, pH 7.2, 40% glycerol
Gene Alias A disintegrin and metalloproteinase with thrombospondin motifs 2, a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 2, ADAM metallopeptidase with thrombospondin type 1 motif, 2, ADAM-TS 2, ADAMTS-2, ADAM-TS2EC 3.4.24.14, ADAMTS-3, EC 3.4.24, NPIDKFZp686F12218, PC I-NP, PCI-NP, PCINPhPCPNI, PCPNI, pNPI, Procollagen I N-proteinase, Procollagen I/II amino propeptide-processing enzyme, Procollagen N-endopeptidase
Värd art Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: IEPLEKGLAAQEAEQGRVHVVYRRPPTSPPLGGPQALDTGASLDSLDSLSRALGVLEEHANSSRRRARRHAADDDYNIEV
Reningsmetod Affinity purified
Kvantitet 25 μg
Regulatorisk status RUO
Forskningsdisciplin Angiogenesis, Cancer, Extracellular Matrix
Primär eller sekundär Primary
Gen-ID (Entrez) 9509
Målarter Human
Innehåll och lagring Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotyp IgG
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.