missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ AIF1 (Human) Recombinant Protein

Human AIF1 full-length ORF ( AAH09474.1, 1 a.a. - 147 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00000199-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16161401

  • 4055.00 SEK / 10µg
Estimated Shipment: 14-06-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKVILMYEEKAREKEKPTGPPAKKAISELP
Specifications

Specifications

AAH09474.1
allograft inflammatory factor 1
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AIF1
GST
199
Wheat germ expression system
10 μg
AIF-1, IBA1, IRT-1
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers