missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ AKR1C2 (Human) Recombinant Protein

Human AKR1C2 full-length ORF ( AAH07024, 1 a.a. - 323 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00001646-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16137104

  • 3343.96 SEK / 10µg

Estimated Shipment: 23-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
Specifications

Specifications

AAH07024
aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III)
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AKR1C2
GST
1646
Wheat germ expression system
10 μg
AKR1C-pseudo, BABP, DD, DD2, DDH2, HAKRD, HBAB, MCDR2
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates