missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Anpassade produkter och tjänster
  4. Anpassade enzymer och inhibitorer
  5. Novus Biologicals™ AKT1/2/3 Inhibitor Peptide Set

Novus Biologicals™ AKT1/2/3 Inhibitor Peptide Set

Produktkod. 18145235 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
2 mg
5 mg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
18145235 2 mg
18115332 5 mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18145235 Leverantör Novus Biologicals™ Leverantörsnummer NBP229332

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

For use in research applications

TRUSTED_SUSTAINABILITY

Specifikationer

Värd art Human
Komponenter Akt (Isoforms 1,2,3) Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKAVTDHPDRLWAWEKF (AKT sequence: AVTDHPDRLWAWEKF). Molecular weight: 4214. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361
För användning med (applikation) Inhibition of Akt kinase activity
Innehåll och lagring Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Kvantitet 2 mg
Produkttyp AKT1/2/3 Inhibitor Peptide Set
Molekylvikt (g/mol) 4214
Inhibitorer AKT1/2/3
Form Lyophilized

For Research Use Only

Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.