missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
ALDH1L2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
5145.00 SEK
Specifikationer
| Antigen | ALDH1L2 |
|---|---|
| Utspädning | Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Användningsområden | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Klassificering | Polyclonal |
| Konjugera | Unconjugated |
| Produktkod | Brand | Kvantitet | Pris | Kvantitet och tillgänglighet | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkod | Brand | Kvantitet | Pris | Kvantitet och tillgänglighet | |||||
|
18269375
|
Novus Biologicals
NBP1-81935 |
0.1 mL |
5145.00 SEK
0.10ml |
Vänligen Logga in för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag! | |||||
Beskrivning
ALDH1L2 Polyclonal specifically detects ALDH1L2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifikationer
| ALDH1L2 | |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| aldehyde dehydrogenase 1 family, member L2, aldehyde dehydrogenase family 1 member L2, DKFZp686A16126, DKFZp686M064, EC 1.5.1.6, FLJ36769, FLJ38508, MGC119536, MGC119537,10-formyltetrahydrofolate dehydrogenase ALDH1L2, Mitochondrial 10-formyltetrahydrofolate dehydrogenase, mtFDHDKFZp686P14145, probable 10-formyltetrahydrofolate dehydrogenase ALDH1L2 | |
| ALDH1L2 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q3SY69 | |
| 160428 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:FGNDGKALTVRNLQFEDGKMIPASQYFSTGETSVVELTAEEVKVAETIKVIWAGILSNVP | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel