missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. AlphaB Crystallin/CRYAB Antibody, R&D Systems™

AlphaB Crystallin/CRYAB Antibody, R&D Systems™

Produktkod. 18603409 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
18603409 0.1 mL
18649696 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18603409 Leverantör Novus Biologicals Leverantörsnummer NBP249246
 Begränsad artikel
Beräknad leverans: 01-12-2026
Lägg i varukorgen
Lägg i varukorgen

missing translation for 'validMainframeMsg'

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

AlphaB Crystallin/CRYAB Polyclonal antibody specifically detects AlphaB Crystallin/CRYAB in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen AlphaB Crystallin/CRYAB
Användningsområden Immunohistochemistry, Immunohistochemistry (Paraffin)
Klassificering Polyclonal
Konjugera Unconjugated
Utspädning Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulering PBS (pH 7.2), 40% Glycerol
Gene Alias alpha B crystallin, alpha(B)-crystallin, alpha-crystallin B chain, CRYA2alpha crystallin B chain, crystallin, alpha B, CTPP2, Heat shock protein beta-5, heat-shock 20 kD like-protein, HSPB5, Renal carcinoma antigen NY-REN-27, Rosenthal fiber component
Värd art Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: KYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAA
Reningsmetod Immunogen affinity purified
Kvantitet 0.1 mL
Regulatorisk status RUO
Forskningsdisciplin Cancer, Cell Biology, Cell Cycle and Replication, Golgi Apparatus Markers, Membrane Trafficking and Chaperones, Neuroscience, Neurotransmission, Protein Phosphatase, Sensory Systems, Signal Transduction, Tyrosine Kinases, Vision
Primär eller sekundär Primary
Gen-ID (Entrez) 1410
Målarter Human
Innehåll och lagring Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Produkttyp Antibody
Form Purified
Isotyp IgG
Produktlinje Novus
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.