missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
Annexin A11 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-90160
Denna artikel kan inte returneras.
Se returpolicy
Beskrivning
Annexin A11 Polyclonal specifically detects Annexin A11 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifikationer
| Annexin A11 | |
| Polyclonal | |
| Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:1000-1:2500 | |
| P50995 | |
| ANXA11 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:QPPVTYPGQPPVPLPGQQQPVPSYPGYPGSGTVTPAVPPTQFGSRGTITDAPGFDPLRDAEVLRKAMKGFGTDEQ | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| annexin A11, Annexin-11, ANX1156-kD, CAP50, CAP-50 | |
| Rabbit | |
| 54 kDa | |
| 0.1 mL | |
| Cancer | |
| 311 | |
| Human | |
| IgG |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering