missing translation for 'onlineSavingsMsg'
Learn More

v-abl Abelson murine leukemia viral oncogene homolog 2 (arg, Abelson-related gene), Mouse, Clone: 5C6, Abnova™

Mouse monoclonal antibody raised against a partial recombinant ABL2.

Brand: Abnova H00000027-M09.100ug

Product Code. 16164224

4510.00 SEK / 100µg

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

This gene encodes a member of the Abelson family of nonreceptor tyrosine protein kinase. The protein is highly similar to the ABL1 protein, including the tyrosine kinase, SH2 and SH3 domains, and has a role in cytoskeletal rearrangements by its C-terminal F-actin- and microtubule-binding sequences. This gene is expressed in both normal and tumor cells, and is involved in translocation with the ETV6 gene in leukemia. Multiple alternatively spliced transcript variants encoding different protein isoforms have been found for this gene. [provided by RefSeq

Sequence: KKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPRGA

Specifications

Antigen	v-abl Abelson murine leukemia viral oncogene homolog 2 (arg, Abelson-related gene)
Classification	Monoclonal
Conjugate	Unconjugated
Formulation	PBS with no preservative; pH 7.4
Gene Accession No.	BC065912
Gene Symbols	ABL2
Immunogen	ABL2 (AAH65912, 743 a.a. ∼ 842 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity	100 μg
Research Discipline	Kinases
Primary or Secondary	Primary
Target Species	Human
Product Type	Antibody

Applications	ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
Clone	5C6
Description	Mouse monoclonal antibody raised against a partial recombinant ABL2.
Gene	ABL2
Gene Alias	ABLL/ARG/FLJ22224/FLJ31718/FLJ41441
Host Species	Mouse
Purification Method	Affinity Purified
Regulatory Status	RUO
Whole Molecule	Yes
Gene ID (Entrez)	27
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Isotype	IgG3 κ

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

v-abl Abelson murine leukemia viral oncogene homolog 2 (arg, Abelson-related gene), Mouse, Clone: 5C6, Abnova™ > 100μg; Unlabeled

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

v-abl Abelson murine leukemia viral oncogene homolog 2 (arg, Abelson-related gene), Mouse, Clone: 5C6, Abnova™

Description

Specifications

Product Suggestions

Documents

Promotions