missing translation for 'onlineSavingsMsg'
Learn More

ATP1B3, Mouse, Clone: 2F4, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant ATP1B3.

Brand:  Abnova H00000483-M05.100ug

Additional Details : Weight : 0.00010kg

Product Code. 16172011

  • 3246.00 SEK / 100µg


Estimated Shipment
04-10-2019
Add to basket

Description

Description

Sequence: MTKNEKKSLNQSLAEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMWVMLQTLNDEVPKYRDQIPSPGLMVFPKPVTALEYTFSRSDPTSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA
Specifications

Specifications

ATP1B3
2F4
Mouse monoclonal antibody raised against a full length recombinant ATP1B3.
ATP1B3
Liquid
ATP1B3
ATP1B3 (AAH11835, 1 a.a. ~ 279 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
100 ug
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal
Human
ELISA
Unconjugated
In 1X PBS, pH 7.4
BC011835
ATPB-3|CD298|FLJ29027
Mouse
IgG2a Kappa
RUO
Primary
483
Videos
Documents