missing translation for 'onlineSavingsMsg'
Learn More

DENN/MADD domain containing 4A, Mouse, Polyclonal Antibody, Abnova™

Name: DENN/MADD domain containing 4A, Mouse, Polyclonal Antibody, Abnova&trade;
Brand: Abnova
SKU: 16122256
Price: 3050.00 EUR

Mouse polyclonal antibody raised against a partial recombinant DENND4A.

Brand: Abnova H00010260-A01.50uL

Additional Details : Weight : 0.00010kg

Product Code. 16122256

Estimated Shipment: 03-06-2024
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Description

Sequence: MIEDKGPRVADYFVVAGLTDVSKPLEEEIHFNDACHKVAKPKEPITDVSVIIKSLGEEVPQDYICIDVTPTGLSADLNNGSLVGPQIYLCYRRGRDKPPLT

Specifications

Antigen	DENN/MADD domain containing 4A
Classification	Polyclonal
Description	Mouse polyclonal antibody raised against a partial recombinant DENND4A.
Gene	DENND4A
Gene Alias	FLJ33949/IRLB/KIAA0476/MYCPBP
Host Species	Mouse
Quantity	50 μL
Whole Molecule	Yes
Gene ID (Entrez)	10260
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Applications	ELISA, Western Blot
Conjugate	Unconjugated
Formulation	50% glycerol
Gene Accession No.	NM_005848
Gene Symbols	DENND4A
Immunogen	DENND4A (NP_005839, 1 a.a. ∼ 101 a.a) partial recombinant protein with GST tag.
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Form	Serum

Product Suggestions

Description