missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. 16160207

F-box protein 11, Mouse, Clone: 4C12, Abnova™

Produktkod. 16160207
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μg
Förpackningsstorlek:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet unitSize
16160207 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 16160207 Leverantör Abnova Leverantörsnummer H00080204M01.100ug

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Mouse monoclonal antibody raised against a partial recombinant FBXO11.

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Sequence: KAVSRGQCLYKISSYTSYPMHDFYRCHTCNTTDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQHN

Specifikationer

Antigen F-box protein 11
Användningsområden ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
Klassificering Monoclonal
Klona 4C12
Konjugera Unconjugated
Beskrivning Mouse monoclonal antibody raised against a partial recombinant FBXO11.
Formulering PBS with no preservative; pH 7.4
Gen FBXO11
Genaccessionsnr. NM_025133
Gene Alias FBX11/FLJ12673/MGC44383/PRMT9/UBR6/UG063H01/VIT1
Gensymboler FBXO11
Värd art Mouse
Immunogen FBXO11 (NP_079409, 744 a.a. ∼ 843 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Reningsmetod Affinity Purified
Kvantitet 100 μg
Regulatorisk status RUO
Forskningsdisciplin Ubiquitin/Proteasome
Primär eller sekundär Primary
Gen-ID (Entrez) 80204
Målarter Human
Innehåll och lagring Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Produkttyp Antibody
Isotyp IgG2a κ
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.