missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. 16188494

GAPDH, Mouse, Polyclonal Antibody, Abnova™

Produktkod. 16188494
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
16188494 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 16188494 Leverantör Abnova Leverantörsnummer H00002597A01.50uL
 Begränsad artikel
Beräknad leverans: 30-12-2026
Lägg i varukorgen
Lägg i varukorgen

missing translation for 'validMainframeMsg'

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Mouse polyclonal antibody raised against a partial recombinant GAPDH.

The product of this gene catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains. Many pseudogenes similar to this locus are present in the human genome. [provided by RefSeq

Sequence: GKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE

Specifikationer

Antigen GAPDH
Användningsområden ELISA, Western Blot
Klassificering Polyclonal
Konjugera Unconjugated
Beskrivning Mouse polyclonal antibody raised against a partial recombinant GAPDH.
Formulering 50% glycerol
Gen GAPDH
Genaccessionsnr. NM_002046
Gene Alias G3PD/GAPD/MGC88685
Gensymboler GAPDH
Värd art Mouse
Immunogen GAPDH (NP_002037, 226 a.a. ∼ 335 a.a) partial recombinant protein with GST tag.
Kvantitet 50 μL
Regulatorisk status RUO
Primär eller sekundär Primary
Gen-ID (Entrez) 2597
Målarter Human
Innehåll och lagring Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Produkttyp Antibody
Form Liquid
Isotyp IgG
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.