missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. 16106469

MOB1, Mps One Binder kinase activator-like 2C (yeast), Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Produktkod. 16106469
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
50 μg
Förpackningsstorlek:
50µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet unitSize
16106469 50 μg 50µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 16106469 Leverantör Abnova Leverantörsnummer H00148932B01P.50ug

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Mouse polyclonal antibody raised against a full-length human MOBKL2C protein.

The protein encoded by this gene is similar to the yeast Mob1 protein. Yeast Mob1 binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq

Sequence: MALCLKQVFAKDKTFRPRKRFEPGTQRFELYKKAQASLKSGLDLRSVVRLPPGENIDDWIAVHVVDFFNRINLIYGTMAERCSETSCPVMAGGPRYEYRWQDERQYRRPAKLSAPRYMALLMDWIEGLINDEEVFPTRVGVPFPKNFQQVCTKILTRLFRVFVHVYIHHFDSILSMGAEAHVNTCYKHFYYFIREFSLVDQRELEPLREMTERICH

Specifikationer

Antigen MOB1, Mps One Binder kinase activator-like 2C (yeast)
Användningsområden Western Blot
Klassificering Polyclonal
Konjugera Unconjugated
Beskrivning Mouse polyclonal antibody raised against a full-length human MOBKL2C protein.
Formulering PBS with no preservative; pH 7.4
Gen MOBKL2C
Genaccessionsnr. NM_201403.1
Gene Alias MGC26743/MOB3C
Gensymboler MOBKL2C
Värd art Mouse
Immunogen MOBKL2C (NP_958805.1, 1 a.a. ∼ 216 a.a) full-length human protein.
Reningsmetod Affinity Purified
Kvantitet 50 μg
Regulatorisk status RUO
Forskningsdisciplin Kinases
Primär eller sekundär Primary
Gen-ID (Entrez) 148932
Målarter Human
Innehåll och lagring Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Produkttyp Antibody
Isotyp IgG
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.