missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. 16126476

par-6 partitioning defective 6 homolog alpha (C. elegans) (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Produktkod. 16126476
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
50 μL
Förpackningsstorlek:
50µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet unitSize
16126476 50 μL 50µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 16126476 Leverantör Abnova Leverantörsnummer H00050855A01.50uL

Please to purchase this item. Need a web account? Register with us today!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Mouse polyclonal antibody raised against a partial recombinant PARD6A.

This gene is a member of the PAR6 family and encodes a protein with a PSD95/Discs-large/ZO1 (PDZ) domain and a semi-Cdc42/Rac interactive binding (CRIB) domain. This cell membrane protein is involved in asymmetrical cell division and cell polarization processes as a member of a multi-protein complex. The protein also has a role in the epithelial-to-mesenchymal transition (EMT) that characterizes the invasive phenotype associated with metastatic carcinomas. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq

Sequence: KPANQRNNVVRGASGRLTGPPSAGPGPAEPDSDDDSSDLVIENRQPPSSNGLSQGPPCWDLHPGCRHPGTRSSLPSLDDQGQASSGWGSRIRGDGSGFSL

Specifikationer

Antigen par-6 partitioning defective 6 homolog alpha (C. elegans)
Användningsområden ELISA, Western Blot
Klassificering Polyclonal
Konjugera Unconjugated
Beskrivning Mouse polyclonal antibody raised against a partial recombinant PARD6A.
Formulering 50% glycerol
Gen PARD6A
Genaccessionsnr. NM_016948
Gene Alias PAR-6A/PAR6/PAR6C/PAR6alpha/TAX40/TIP-40
Gensymboler PARD6A
Värd art Mouse
Immunogen PARD6A (NP_058644, 247 a.a. ∼ 346 a.a) partial recombinant protein with GST tag.
Kvantitet 50 μL
Regulatorisk status RUO
Forskningsdisciplin Cell Cycle
Hela molekylen Yes
Primär eller sekundär Primary
Gen-ID (Entrez) 50855
Målarter Human
Innehåll och lagring Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.