missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. 16168835

pyridoxal (pyridoxine, vitamin B6) kinase (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Produktkod. 16168835
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
16168835 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 16168835 Leverantör Abnova Leverantörsnummer H00008566A01.50uL

Please to purchase this item. Need a web account? Register with us today!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Mouse polyclonal antibody raised against a partial recombinant PDXK.

The protein encoded by this gene phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. The encoded protein is cytoplasmic and probably acts as a homodimer. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq

Sequence: HWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGR

Specifikationer

Antigen pyridoxal (pyridoxine, vitamin B6) kinase
Användningsområden ELISA, Western Blot
Klassificering Polyclonal
Konjugera Unconjugated
Beskrivning Mouse polyclonal antibody raised against a partial recombinant PDXK.
Formulering 50% glycerol
Gen PDXK
Genaccessionsnr. NM_003681
Gene Alias C21orf124/C21orf97/DKFZp566A071/FLJ31940/FLJ37311/MGC15873/MGC31754/MGC52346/PKH/PNK/PRED79
Gensymboler PDXK
Värd art Mouse
Immunogen PDXK (NP_003672, 51 a.a. ∼ 160 a.a) partial recombinant protein with GST tag.
Kvantitet 50 μL
Regulatorisk status RUO
Hela molekylen Yes
Primär eller sekundär Primary
Gen-ID (Entrez) 8566
Målarter Human
Innehåll och lagring Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.