missing translation for 'onlineSavingsMsg'
Läs mer

sterol carrier protein 2, Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Produktkod. 16104995
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
50 μg
Förpackningsstorlek:
50µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet unitSize
16104995 50 μg 50µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 16104995 Leverantör Abnova Leverantörsnummer H00006342B01P.50ug

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Mouse polyclonal antibody raised against a full-length human SCP2 protein.

This gene encodes two proteins: sterol carrier protein X (SCPx) and sterol carrier protein 2 (SCP2), as a result of transcription initiation from 2 independently regulated promoters. The transcript initiated from the proximal promoter encodes the longer SCPx protein, and the transcript initiated from the distal promoter encodes the shorter SCP2 protein, with the 2 proteins sharing a common C-terminus. Evidence suggests that the SCPx protein is a peroxisome-associated thiolase that is involved in the oxidation of branched chain fatty acids, while the SCP2 protein is thought to be an intracellular lipid transfer protein. This gene is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms. The full-length nature of all transcript variants has not been determined. [provided by RefSeq

Sequence: MSSSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQIPYSAVDQACVGYVFGVAECVLALGFEKMSKGSLGIKFSDRTIPTDKHVDLLINKYGLSAHPVAPQMFGYAGKEHMEKYGTKIEHFAKIGWKNHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILASEAFVQKYGLQSKAVEILAQEMMTDLPSSFEEKSIIKMVGFDMSKEAARKCYEKSGLTPNDIDVIELHDCFSTNELLTYEALGLCPEGQGATLVDRGDNTYGGKWVINPSGGLISKGHPLGATGGHSCS

Specifikationer

Antigen sterol carrier protein 2
Användningsområden Western Blot
Klassificering Polyclonal
Konjugera Unconjugated
Beskrivning Mouse polyclonal antibody raised against a full-length human SCP2 protein.
Formulering PBS with no preservative; pH 7.4
Gen SCP2
Genaccessionsnr. NM_001007098
Gene Alias DKFZp686C12188/DKFZp686D11188/NLTP/NSL-TP/SCPX
Gensymboler SCP2
Värd art Mouse
Immunogen SCP2 (NP_001007099, 1 a.a. ∼ 322 a.a) full-length human protein.
Reningsmetod Affinity Purified
Kvantitet 50 μg
Regulatorisk status RUO
Primär eller sekundär Primary
Gen-ID (Entrez) 6342
Målarter Human
Innehåll och lagring Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Produkttyp Antibody
Isotyp IgG
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.