missing translation for 'onlineSavingsMsg'
Läs mer

SH2 domain protein 1A, Mouse, Clone: 1C9, Abnova™

Produktkod. 16197491
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
16197491 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 16197491 Leverantör Abnova Leverantörsnummer H00004068M01.100ug

Please to purchase this item. Need a web account? Register with us today!

Denna artikel kan inte returneras. Se returpolicy

Mouse monoclonal antibody raised against a full-length recombinant SH2D1A.

This gene encodes a protein that plays a major role in the bidirectional stimulation of T and B cells. This protein contains an SH2 domain and a short tail. It associates with the signaling lymphocyte-activation molecule, thereby acting as an inhibitor of this transmembrane protein by blocking the recruitment of the SH2-domain-containing signal-transduction molecule SHP-2 to its docking site. This protein can also bind to other related surface molecules that are expressed on activated T, B and NK cells, thereby modifying signal transduction pathways in these cells. Mutations in this gene cause lymphoproliferative syndrome X-linked type 1 or Duncan disease, a rare immunodeficiency characterized by extreme susceptibility to infection with Epstein-Barr virus, with symptoms including severe mononucleosis and malignant lymphoma. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP

Specifikationer

Antigen SH2 domain protein 1A
Användningsområden ELISA, Western Blot
Klassificering Monoclonal
Klona 1C9
Konjugera Unconjugated
Beskrivning Mouse monoclonal antibody raised against a full length recombinant SH2D1A.
Formulering PBS with no preservative; pH 7.4
Gen SH2D1A
Genaccessionsnr. BC020732
Gene Alias DSHP/EBVS/FLJ18687/FLJ92177/IMD5/LYP/MTCP1/SAP/XLP/XLPD
Gensymboler SH2D1A
Värd art Mouse
Immunogen SH2D1A (AAH20732, 1 a.a. ∼ 128 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Reningsmetod Affinity Purified
Kvantitet 100 μg
Regulatorisk status RUO
Forskningsdisciplin Membrane Receptors
Primär eller sekundär Primary
Gen-ID (Entrez) 4068
Målarter Human
Innehåll och lagring Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Produkttyp Antibody
Isotyp IgG2a κ
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.