missing translation for 'onlineSavingsMsg'
Läs mer

synaptic vesicle glycoprotein 2B, Mouse, Polyclonal Antibody, Abnova™

Produktkod. 16171426
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
16171426 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 16171426 Leverantör Abnova Leverantörsnummer H00009899A01.50uL

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Mouse polyclonal antibody raised against a partial recombinant SV2B.

Sequence: YFQDEEYKSKMKVFFGEHVYGATINFTMENQIHQHGKLVNDKFTRMYFKHVLFEDTFFDE

Specifikationer

Antigen synaptic vesicle glycoprotein 2B
Användningsområden ELISA, Western Blot
Klassificering Polyclonal
Konjugera Unconjugated
Beskrivning Mouse polyclonal antibody raised against a partial recombinant SV2B.
Formulering 50% glycerol
Gen SV2B
Genaccessionsnr. NM_014848
Gene Alias HsT19680/KIAA0735
Gensymboler SV2B
Värd art Mouse
Immunogen SV2B (NP_055663, 417 a.a. ∼ 476 a.a) partial recombinant protein with GST tag.
Kvantitet 50 μL
Regulatorisk status RUO
Hela molekylen Yes
Primär eller sekundär Primary
Gen-ID (Entrez) 9899
Målarter Human
Innehåll och lagring Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.