missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. 16136225

TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa, Mouse, Clone: 3G6, Abnova™

Produktkod. 16136225
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μg
Förpackningsstorlek:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet unitSize
16136225 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 16136225 Leverantör Abnova Leverantörsnummer H00006879M02.100ug

Please to purchase this item. Need a web account? Register with us today!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Mouse monoclonal antibody raised against a partial recombinant TAF7.

The intronless gene for this transcription coactivator is located between the protocadherin beta and gamma gene clusters on chromosome 5. The protein encoded by this gene is a component of the TFIID protein complex, a complex which binds to the TATA box in class II promoters and recruits RNA polymerase II and other factors. This particular subunit interacts with the largest TFIID subunit, as well as multiple transcription activators. The protein is required for transcription by promoters targeted by RNA polymerase II. [provided by RefSeq

Sequence: FIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHRQGHDSLEHDELREIFN

Specifikationer

Antigen TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa
Användningsområden ELISA, Western Blot
Klassificering Monoclonal
Klona 3G6
Konjugera Unconjugated
Beskrivning Mouse monoclonal antibody raised against a partial recombinant TAF7.
Formulering PBS with no preservative; pH 7.4
Gen TAF7
Genaccessionsnr. BC032737
Gene Alias TAF2F/TAFII55
Gensymboler TAF7
Värd art Mouse
Immunogen TAF7 (AAH32737, 130 a.a. ∼ 224 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Reningsmetod Affinity Purified
Kvantitet 100 μg
Regulatorisk status RUO
Hela molekylen Yes
Primär eller sekundär Primary
Gen-ID (Entrez) 6879
Målarter Human
Innehåll och lagring Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Produkttyp Antibody
Isotyp IgG2a κ
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.