missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ APEX1 (Human) Recombinant Protein

Human APEX1 full-length ORF ( AAH02338, 1 a.a. - 318 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00000328-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16161671

  • 4055.00 SEK / 10µg
Estimated Shipment: 27-06-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL
Specifications

Specifications

AAH02338
APEX nuclease (multifunctional DNA repair enzyme) 1
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
APEX1
GST
328
Wheat germ expression system
10 μg
APE, APE-1, APE1, APEN, APEX, APX, HAP1, REF-1, REF1
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers