missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ APLP2 (Human) Recombinant Protein

Human APLP2 partial ORF ( AAH00373, 41 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00000334-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16161691

  • 4055.00 SEK / 10µg
Estimated Shipment: 22-06-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: AGTGFAVAEPQIAMFCGKLNMHVNIQTGKWEPDPTGTKSCFETKEEVLQYCQEMYPELQITNVMEANQRVSIDNWCRRDKKQCKSRFVTPFKCLVGEFVSDVLLVPEKCQ
Specifications

Specifications

AAH00373
amyloid beta (A4) precursor-like protein 2
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
APLP2
GST
334
Wheat germ expression system
10 μg
APPH, APPL2, CDEBP
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers