missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ APOA1 (Human) Recombinant Protein

Human APOA1 full-length ORF ( AAH05380, 1 a.a. - 267 a.a.) recombinant protein with GST-tag at N-terminal.

Marke:  Abnova™ H00000335-P01.10ug

Weitere Details : Weight : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16121701

  • 4055.00 SEK / 10µg
Estimated Shipment: 27-06-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Beschreibung

Beschreibung

  • Sequence: MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ
Spezifikation

Spezifikation

AAH05380
apolipoprotein A-I
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
APOA1
GST
335
Wheat germ expression system
10 μg
MGC117399
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate
Sonderangebote

Sonderangebote