missing translation for 'onlineSavingsMsg'
Learn More

Print

Abnova™ AR (Human) Recombinant Protein

Human AR partial ORF ( NP_000035, 221 a.a. - 320 a.a.) recombinant protein with GST-tag at N-terminal.

4055.00 SEK - 6150.00 SEK

Specifications

Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene ID (Entrez)	367

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
16161761 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00000367-Q01.10UG	10 μg	4055.00 SEK 10µg View alternative products Save Up to »	Estimated Shipment: 28-07-2022 Log in to see stock.	Please sign in to purchase this item. Need a web account? Register with us today!
16171761 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00000367-Q01.25UG	25 μg	6150.00 SEK 25µg View alternative products Save Up to »	Estimated Shipment: 28-07-2022 Log in to see stock.	Please sign in to purchase this item. Need a web account? Register with us today!

Description

Description

Sequence: SKDNYLGGTSTISDNAKELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAGKSTEDTAEYSPFKGGYTKGL

Specifications

Specifications

Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene ID (Entrez)	367

Back to Top