missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ ARF3 (Human) Recombinant Protein

Human ARF3 full-length ORF ( AAH07762, 1 a.a. - 181 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00000377-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16131791

  • 3343.96 SEK / 10µg

Estimated Shipment: 18-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: MGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK
Specifications

Specifications

AAH07762
ADP-ribosylation factor 3
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
377
Wheat germ expression system
10 μg
ARF3
GST
Videos
SDS
Documents
Certificates