missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. 18614497

ARSJ Antibody, R&D Systems™

Artikelnummer. 18614497 Alle ansehen Bio Techne Produkte
Ansicht ändern
Click to view available options
Kvantitet:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Kvantitet
18614497 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18614497 Lieferant Novus Biologicals Lieferanten-Nr. NBP248658
  • ONLINE EXCLUSIVE PRICE
    6067.01 SEK
    5156.55 SEK / 0.1ml
    Save 910.46 SEK
    15% Av
 Begränsad artikel
Beräknad leverans: 02-12-2026
Zum Warenkorb hinzufügen
Zum Warenkorb hinzufügen

missing translation for 'validMainframeMsg'

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

ARSJ Polyclonal antibody specifically detects ARSJ in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen ARSJ
Användningsområden Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Klassificering Polyclonal
Konjugera Unconjugated
Utspädning Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulering PBS (pH 7.2) and 40% Glycerol
Gene Alias arylsulfatase family, member J, arylsulfatase J, ASJ, EC 3.1.6, EC 3.1.6.-, EC 3.1.6.12, FLJ23548
Värd art Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: TADPYERVDLSNRYPGIVKKLLRRLSQFNKTAVPVRYPPKDPRSNPRLNGGVWGPWYKEETKK
Reningsmetod Immunogen affinity purified
Kvantitet 0.1 mL
Regulatorisk status RUO
Forskningsdisciplin Lipid and Metabolism
Primär eller sekundär Primary
Gen-ID (Entrez) 79642
Målarter Human
Innehåll och lagring Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Produkttyp Antibody
Form Purified
Isotyp IgG
Produktlinje Novus
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.