missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ ASL (Human) Recombinant Protein

Name: Abnova&trade; ASL (Human) Recombinant Protein
Brand: Abnova&trade;
SKU: 16161941
Price: 6845.00 EUR

Human ASL full-length ORF ( AAH08195, 1 a.a. - 464 a.a.) recombinant protein with GST-tag at N-terminal.

Brand: Abnova™ H00000435-P01.25ug

Additional Details : Weight : 0.00010kg

Product Code. 16161941

Estimated Shipment: 29-05-2024
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Description

Sequence: MASESGKLWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKVAEEWAQGTFKLNSNDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVAELLFWASLCMTHLSRMAEDLILYCTKEFSFVQPSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVISTLQIHQENMGQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLFSGDVICVWDYGHSVEQYGALGGTARSSVDWQIRQVRALLQAQQA

Specifications

Accession Number	AAH08195
Name	argininosuccinate lyase
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	ASL
Protein Tag	GST

Gene ID (Entrez)	435
Preparation Method	Wheat germ expression system
Quantity	25 μg
Gene Alias	ASAL
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Product Suggestions

Description