missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Biokemiska reagenser
  4. Peptider
  5. 18287443

Novus Biologicals™ ASNSD1 Recombinant Protein Antigen

Produktkod. 18287443 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μl
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
18287443 100 μl
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18287443 Leverantör Novus Biologicals™ Leverantörsnummer NBP257925PEP
 Begränsad artikel
Beräknad leverans: 27-11-2026
Lägg i varukorgen
Lägg i varukorgen

missing translation for 'validMainframeMsg'

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ASNSD1. Source: E.coli Amino Acid Sequence: KLRRTRICHLIRPLDTVLDDSIGCAVWFASRGIGWLVAQEGVKSYQSNAKVVLTGIGADEQLAGYSRHRVRFQSHGLEGLNKE The ASNSD1 Recombinant Protein Antigen is derived from E. coli. The ASNSD1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Specifikationer

Gen-ID (Entrez) 54529
Reningsmetod >80% by SDS-PAGE and Coomassie blue staining
Vanligt namn ASNSD1 Recombinant Protein Antigen
Innehåll och lagring Store at −20°C. Avoid freeze-thaw cycles
Formulering PBS and 1M Urea, pH 7.4
För användning med (applikation) Blocking/Neutralizing, Control
Gene Alias asparagine synthetase domain containing 1, asparagine synthetase domain-containing protein 1, HCV NS3-transactivated protein 1, NBLA00058, NS3TP1FLJ20752
Gensymbol ASNSD1
Etiketttyp Unlabeled
Produkttyp Recombinant Protein Antigen
Kvantitet 100 μl
Regulatorisk status RUO
Källa E.coli
Specifik reaktivitet This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53520. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Visa mer Visa mindre

For research use only.

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.