missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Bcl-2 related protein A1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
4480.00 SEK
Specifications
Antigen | Bcl-2 related protein A1 |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
Bcl-2 related protein A1 Polyclonal specifically detects Bcl-2 related protein A1 in Human samples. It is validated for Western Blot.Specifications
Bcl-2 related protein A1 | |
Western Blot | |
Unconjugated | |
Rabbit | |
Apoptosis, Cancer | |
PBS buffer, 2% sucrose | |
597 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
Human | |
ACC-1, ACC-2, Bcl2-L-5, BCL2L5HBPA1, Bcl-2-like protein 5, BCL2-related protein A1, BFL1bcl-2-related protein A1, GRSbcl2-L-5, hematopoietic BCL2-related protein A1, Hemopoietic-specific early response protein, Protein BFL-1, Protein GRS | |
The immunogen is a synthetic peptide directed towards the C terminal region of human Bcl-2 related protein A1 (NP_004040). Peptide sequence FIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQY | |
Affinity purified |