missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BHMT2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-10794-100UL
This item is not returnable.
View return policy
Description
BHMT2 Polyclonal specifically detects BHMT2 in Human samples. It is validated for Western Blot.Specifications
BHMT2 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
betaine-homocysteine methyltransferase 2, betaine--homocysteine S-methyltransferase 2, EC 2.1.1.5, FLJ20001 | |
The immunogen is a synthetic peptide directed towards the middle region of human BHMT2 (NP_001171476.1). Peptide sequence FTFSASEDNMESKWEDVNAAACDLAREVAGKGDALVAGGICQTSIYKYQK | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
23743 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |