missing translation for 'onlineSavingsMsg'
Learn More

BJHCC20A Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-17470-100UL

Product Code. 18337244

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

BJHCC20A Polyclonal antibody specifically detects BJHCC20A in Human samples. It is validated for Immunofluorescence

Specifications

Antigen	BJHCC20A
Classification	Polyclonal
Dilution	Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Gene Alias	BJHCC20A, Cancer/testis antigen 55, chromosome X open reading frame 48, CT55, CT55 BRCA2-interacting protein, CXorf48, FLJ20527, RP13-565O16.1, Tumor antigen BJ-HCC-20
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: GNVPLKVGQKVNVVVEEDKPHYGLRAIKVDVVPRHLYGAGPSDSGTRVLIG
Quantity	100 μg
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Applications	Immunofluorescence
Conjugate	Unconjugated
Formulation	PBS, pH 7.2, 40% glycerol
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Gene ID (Entrez)	54967
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype	IgG

Product Suggestions

Description