missing translation for 'onlineSavingsMsg'
Learn More

BJHCC20A Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

5775.00 SEK

Antigen	BJHCC20A
Dilution	Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Applications	Immunofluorescence
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 1

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
18337244 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP3-17470-100UL	100 μg	5775.00 SEK 100µL		Please sign in to purchase this item. Need a web account? Register with us today!

Description

BJHCC20A Polyclonal antibody specifically detects BJHCC20A in Human samples. It is validated for Immunofluorescence

Specifications

Antigen	BJHCC20A
Applications	Immunofluorescence
Conjugate	Unconjugated
Host Species	Rabbit
Target Species	Human
Gene Alias	BJHCC20A, Cancer/testis antigen 55, chromosome X open reading frame 48, CT55, CT55 BRCA2-interacting protein, CXorf48, FLJ20527, RP13-565O16.1, Tumor antigen BJ-HCC-20
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: GNVPLKVGQKVNVVVEEDKPHYGLRAIKVDVVPRHLYGAGPSDSGTRVLIG
Primary or Secondary	Primary
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Dilution	Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Formulation	PBS, pH 7.2, 40% glycerol
Gene ID (Entrez)	54967
Isotype	IgG
Purification Method	Affinity purified

Description