missing translation for 'onlineSavingsMsg'
Learn More

BMP7 Recombinant Protein, Abnova

Human full-length ORF recombinant protein with GST-tag at N-terminal.

Brand:  Abnova H00000655-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16182291

  • 5030.41 SEK / 25µg

Estimated Shipment: 06-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Bone morphogenetic proteins (BMPs) belongs to family of secreted signaling molecules
  • Induces ectopic bone growth
  • Molecular weight: 73.15kDa
  • Preparation method:in vitro wheat germ expression system
  • Purification: glutathione Sepharose 4 fast flow
  • Storage buffer: 50 mM Tris-HCI, 10 mM reduced glutathione
  • pH=8.0 in the elution buffer

Sequence: MHVRSLRAAAPHSFVALWAPLFLLRSALADFSLDNEVHSSFIHRRLRSQERREMQREILSILGLPHRPRPHLQGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQDSHFLTDADMVMSFVNLVEHDKEFFHPRYHHREFRFDLSKIPEGEAVTAAEFRIYKDYIRERFDNE
TFRISVYQVLQEHLGRESDLFLLDSRTLWASEEGWLVFDITATSNHWVVNPRHNLGLQLSVETLDGQSINPKLAGLIGRHGPQNKQPFMVAFFKATEVHFRSIRSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH

Best when used within three months from the date of receipt of this protein.

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Specifications

Antibody Production, ELISA, Protein Array, Western Blotting (Recombinant Protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Human BMP7 Full-length ORF Recombinant Protein with GST-tag at N-terminal
In vitro wheat germ expression system
12.5% SDS-PAGE stained with Coomassie Blue
Wheat Germ (in vitro)
Human
Solution
73.15
8
Glutathione Sepharose 4 Fast Flow
25μg
-80°C
Yes
Videos
SDS
Documents
Certificates