missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ BMP7 Recombinant Protein
Human full-length ORF recombinant protein with GST-tag at N-terminal.
Brand: Abnova™ H00000655-P01.25ug
Additional Details : Weight : 0.00010kg
Description
- Bone morphogenetic proteins (BMPs) belongs to family of secreted signaling molecules
- Induces ectopic bone growth
- Molecular weight: 73.15kDa
- Preparation method:in vitro wheat germ expression system
- Purification: glutathione Sepharose 4 fast flow
- Storage buffer: 50 mM Tris-HCI, 10 mM reduced glutathione
- pH=8.0 in the elution buffer
Sequence: MHVRSLRAAAPHSFVALWAPLFLLRSALADFSLDNEVHSSFIHRRLRSQERREMQREILSILGLPHRPRPHLQGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQDSHFLTDADMVMSFVNLVEHDKEFFHPRYHHREFRFDLSKIPEGEAVTAAEFRIYKDYIRERFDNE
TFRISVYQVLQEHLGRESDLFLLDSRTLWASEEGWLVFDITATSNHWVVNPRHNLGLQLSVETLDGQSINPKLAGLIGRHGPQNKQPFMVAFFKATEVHFRSIRSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH
Best when used within three months from the date of receipt of this protein.
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifications
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 73.15 | |
| 8 | |
| Glutathione Sepharose 4 Fast Flow | |
| 25μg | |
| -80°C | |
| Recombinant |
| 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
| Human BMP7 Full-length ORF Recombinant Protein with GST-tag at N-terminal | |
| In vitro wheat germ expression system | |
| 12.5% SDS-PAGE stained with Coomassie Blue | |
| Wheat Germ (in vitro) | |
| Human | |
| Solution |