missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ C18orf43 Recombinant Protein

Name: Abnova&trade; C18orf43 Recombinant Protein
Brand: Abnova&trade;
SKU: 16135502
Price: 4515.00 EUR

Brand: Abnova™ H00010650-P01.10ug

Additional Details : Weight : 0.00010kg

Product Code. 16135502

Estimated Shipment: 23-05-2024
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Accession Number	AAH07528
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Molecular Weight (g/mol)	31.9
pH Range	8
Purification Method	Glutathione Sepharose 4 Fast Flow
Quantity	10 ug
Immunogen	MRGEGWGPGVSRPFLQAVPAPSSLPLPCPGDILRPGWRPCLAACQPHLLGLEAMDPS
Gene Alias	C18orf43/DKFZp547K106/FLJ31484/HFL-EDDG1/MGC120170/PRELID3A
Gene Symbol	SLMO1
Species	Wheat Germ (in vitro)
Protein Tag	GST

For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Gene ID (Entrez)	10650
Name	C18orf43 (Human) Recombinant Protein (P01)
Preparation Method	In vitro wheat germ expression system
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Source	Wheat Germ (in vitro)
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Common Name	SLMO1
Cross Reactivity	Human
Recombinant	Recombinant
Form	Solution

Product Suggestions

Description